Recombinant Human GPER/GPR30 Protein
Novus Biologicals | Catalog # H00002852-G01
Key Product Details
Source
Applications
Product Specifications
Description
Source: Wheat Germ (in vitro) with proprietary liposome technology
Amino Acid Sequence: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
Protein / Peptide Type
Formulation, Preparation, and Storage
H00002852-G01
| Preparation Method | in vitro wheat germ expression system with proprietary liposome technology |
| Formulation | 25 mM Tris-HCl pH8.0 in 2% glycerol. |
| Preservative | Glycerol |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: GPER/GPR30
Long Name
Alternate Names
Gene Symbol
Additional GPER/GPR30 Products
Product Documents for Recombinant Human GPER/GPR30 Protein
Product Specific Notices for Recombinant Human GPER/GPR30 Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Recombinant Human GPER/GPR30 Protein
There are currently no reviews for this product. Be the first to review Recombinant Human GPER/GPR30 Protein and earn rewards!
Have you used Recombinant Human GPER/GPR30 Protein?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review