GPI-PLD/GPLD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84999

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPI-PLD/GPLD1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPI-PLD/GPLD1. Peptide sequence: GKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GPI-PLD/GPLD1 Antibody - BSA Free

Western Blot: GPI-PLD/GPLD1 Antibody [NBP2-84999]

Western Blot: GPI-PLD/GPLD1 Antibody [NBP2-84999]

Western Blot: GPI-PLD/GPLD1 Antibody [NBP2-84999] - WB Suggested Anti-GPLD1 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole CellGPLD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Applications for GPI-PLD/GPLD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPI-PLD/GPLD1

Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol(GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPIdegrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage inproteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.(provided by RefSeq)

Long Name

Glycosylphosphatidylinositol Specific Phospholipase D1

Alternate Names

Glycoprotein Phospholipase D, GPIPLD, GPIPLDM, GPLD1, PIGPLD1, PLD

Gene Symbol

GPLD1

Additional GPI-PLD/GPLD1 Products

Product Documents for GPI-PLD/GPLD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPI-PLD/GPLD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPI-PLD/GPLD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPI-PLD/GPLD1 Antibody - BSA Free and earn rewards!

Have you used GPI-PLD/GPLD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies