GPR107 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82922

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR107 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR107. Peptide sequence: SKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GPR107 Antibody - BSA Free

Western Blot: GPR107 Antibody [NBP2-82922]

Western Blot: GPR107 Antibody [NBP2-82922]

Western Blot: GPR107 Antibody [NBP2-82922] - Host: Rabbit. Target Name: GP107. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Applications for GPR107 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR107

The GPR107 gene encodes protein GPR107 that in isoform 1 is 600 amino acids long, 66 kDA, in isoform 2 is 552 amino acids long, 61 KDA, and in isoform 3 is 300 amino acids long, 33 kDA. GPR107 is known to interact with the gene UBC. It has been researched regarding its role in nail-patella syndrome, basal cell carcinoma, spina bifida, and focal dermal hypoplasia.

Long Name

G Protein-coupled Receptor 107

Alternate Names

BA138E2.2, KIAA1624, LUSTR1

Gene Symbol

GPR107

Additional GPR107 Products

Product Documents for GPR107 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR107 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR107 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR107 Antibody - BSA Free and earn rewards!

Have you used GPR107 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies