GPR176 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09730

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR176 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR176 (NP_009154). Peptide sequence LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GPR176 Antibody - BSA Free

Western Blot: GPR176 Antibody [NBP3-09730]

Western Blot: GPR176 Antibody [NBP3-09730]

Western Blot: GPR176 Antibody [NBP3-09730] - Western blot analysis of GPR176 in PANC1 Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for GPR176 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR176

The GPR176 gene is a member of the G protein-coupled receptor family and is described as an orphan receptor. It works as cell surface receptors involved in various responses such as to hormones, growth factors, and neurotransmitters. The protein encoded by the GPR176 gene is 515 amino acids long at nearly 57 kDA in mass. GPR176 is involved with GPCRs.

Long Name

G Protein-coupled Receptor 176

Alternate Names

G protein-coupled receptor 176, Gm1012, GPR, HB-954, probable G-protein coupled receptor 176, putative G protein coupled receptor

Gene Symbol

GPR176

Additional GPR176 Products

Product Documents for GPR176 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR176 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPR176 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR176 Antibody - BSA Free and earn rewards!

Have you used GPR176 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies