GPR18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87522

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GPR18 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GPR18. Peptide sequence: GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIYLKAVNVLNLTRLT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GPR18 Antibody - BSA Free

Western Blot: GPR18 Antibody [NBP2-87522]

Western Blot: GPR18 Antibody [NBP2-87522]

Western Blot: GPR18 Antibody [NBP2-87522] - WB Suggested Anti-GPR18 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Muscle

Applications for GPR18 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPR18

GPR18 is an Orphan-A GPCR with no known ligand. GPR18 has been reported to be expressed at high levels in testis and spleen and at lower levels in other tissues associated with endocrine and immunologic/hematologic functions. ESTs have been isolated from human blood, bone marrow, brain, colon, liver/spleen, lymph, lymph node, testis, and tonsil libraries.

Long Name

G Protein-coupled Receptor 18

Alternate Names

GPCRW, NAGly Receptor

Gene Symbol

GPR18

Additional GPR18 Products

Product Documents for GPR18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPR18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for GPR18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPR18 Antibody - BSA Free and earn rewards!

Have you used GPR18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies