GPRC6A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82243

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A. Peptide sequence: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

103 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit GPRC6A Antibody - BSA Free (NBP2-82243) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for GPRC6A Antibody - BSA Free

Western Blot: GPRC6A Antibody [NBP2-82243]

Western Blot: GPRC6A Antibody [NBP2-82243]

Western Blot: GPRC6A Antibody [NBP2-82243] - Host: Rabbit. Target Name: GPRC6A. Sample Tissue: Human HCT15 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: GPRC6A Antibody [NBP2-82243]

Western Blot: GPRC6A Antibody [NBP2-82243]

Western Blot: GPRC6A Antibody [NBP2-82243] - WB Suggested Anti-GPRC6A Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell
Western Blot: GPRC6A Antibody [NBP2-82243]

Western Blot: GPRC6A Antibody [NBP2-82243]

Western Blot: GPRC6A Antibody [NBP2-82243] - Host: Rabbit. Target Name: GPRC6A. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml

Applications for GPRC6A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GPRC6A

GPRC6A has been shown to bind to L-alpha-amino acids. Recently GPRC6A has been suggested to be a calcium-sensing receptor (Pi et al. 2005).

Long Name

G Protein-coupled Receptor, Family C, Group 6, Member A

Alternate Names

bA86F4.3, GPCR33

Gene Symbol

GPRC6A

Additional GPRC6A Products

Product Documents for GPRC6A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GPRC6A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPRC6A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPRC6A Antibody - BSA Free and earn rewards!

Have you used GPRC6A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...