Guanylyl Cyclase beta 1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-24889PEP

Novus Biologicals
100% Guarantee

Key Product Details

Applications

Antibody Competition
View all Guanylyl Cyclase beta 1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Guanylyl Cyclase beta 1

Source: E.coli

Amino Acid Sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24889It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-24889PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Guanylyl Cyclase beta 1

Guanylate Cyclase is an heterodimer of an alpha and a beta chain. Its enzymatic activity transforms GTP to GMP releasing a diphosphate. It binds 1 or 2 hemes per heterodimer. It is activated by nitric oxide in the presence of magnesium or manganese ions. There are two types of guanylate cyclase: soluble form and membrane-associated receptor form.

Alternate Names

EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit

Gene Symbol

GUCY1B1

Additional Guanylyl Cyclase beta 1 Products

Product Documents for Guanylyl Cyclase beta 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Guanylyl Cyclase beta 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Guanylyl Cyclase beta 1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Guanylyl Cyclase beta 1 Recombinant Protein Antigen and earn rewards!

Have you used Guanylyl Cyclase beta 1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes