HAND2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74185

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to the C terminal of Hand2. Immunizing peptide sequence DQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HAND2 Antibody - BSA Free

Western Blot: HAND2 Antibody [NBP1-74185]

Western Blot: HAND2 Antibody [NBP1-74185]

Western Blot: HAND2 Antibody [NBP1-74185] - Titration: 1.0 ug/ml Positive Control: Mouse Heart
Western Blot: HAND2 Antibody [NBP1-74185]

Western Blot: HAND2 Antibody [NBP1-74185]

Western Blot: HAND2 Antibody [NBP1-74185] - WB detection of Hand2 protein in mouse heart lysate with rabbit polyclonal HAND2 antibody used at 1.0ug/ml concentration.
Western Blot: HAND2 Antibody [NBP1-74185]

Western Blot: HAND2 Antibody [NBP1-74185]

Western Blot: HAND2 Antibody [NBP1-74185] - Sample Type: Mouse Heart lysates Antibody Dilution: 1.0ug/ml

Applications for HAND2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAND2

Hand2 is essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. It is required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. It plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Hand2 is involved in the development of branchial arches, which give rise to unique structures in the head and neck.

Long Name

Heart And Neural Crest Derivatives Expressed 2

Alternate Names

dHand, Ehand2, Hed, Th2, Thing2

Gene Symbol

HAND2

UniProt

Additional HAND2 Products

Product Documents for HAND2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HAND2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAND2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAND2 Antibody - BSA Free and earn rewards!

Have you used HAND2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...