HAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86664

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HAP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HAP1. Peptide sequence: ETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit HAP1 Antibody - BSA Free (NBP2-86664) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HAP1 Antibody - BSA Free

Western Blot: HAP1 Antibody [NBP2-86664]

Western Blot: HAP1 Antibody [NBP2-86664]

Western Blot: HAP1 Antibody [NBP2-86664] - Host: Rabbit. Target Name: HAP1. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for HAP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAP1

Huntington's disease is an autosomal dominant neurodegenerative disorder caused by an expanded polyglutamine repeat region in the huntingtin gene. Huntingtin-associated protein 1 (HAP1) is a huntingtin associated protein that shows neuronal localization and moves with huntingtin in nerve fibers. The ability of HAP1 to bind to huntingtin is enhanced by the expanded polyglutamine repeat region that is typical of the mutant form of the protein associated with Huntington's disease.

Defects with HAP1 can lead to Huntington's disease, and HAP1 antibodies are therefore useful tools for Huntington's disease research and neuroscience studies.

Alternate Names

HAP2huntingtin-associated protein 2, hHLP1, HIP5, HLP1, HLPHAP-1, huntingtin-associated protein 1, Neuroan 1

Gene Symbol

HAP1

Additional HAP1 Products

Product Documents for HAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAP1 Antibody - BSA Free and earn rewards!

Have you used HAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies