HAPLN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87555

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HAPLN2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HAPLN2. Peptide sequence: YQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HAPLN2 Antibody - BSA Free

Western Blot: HAPLN2 Antibody [NBP2-87555]

Western Blot: HAPLN2 Antibody [NBP2-87555]

Western Blot: HAPLN2 Antibody [NBP2-87555] - WB Suggested Anti-HPLN2 antibody Titration: 1 ug/mL. Sample Type: Human U937 Whole Cell

Applications for HAPLN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAPLN2

The 340 amino acid long, 37 kDA hyaluronan and proteoglycan link protein 2 encoded by the HAPLN2 gene monitors binding of versication V2 to hyaluronic acid. This protein may be a participant in the formation of the hyaluronan-associated matrix in the central nervous system (CNS). This matrix encourages neuronal confuction and structural stabilization. HAPLN2 participates in PTEN pathway, MAPK signaling, UPA-UPAR pathway, and transendothelial migration of leukocytes. It has been researched regarding its role in rabies, schizophrenia, neuronitis, and malignant glioma.

Long Name

Hyaluronan And Proteoglycan Link Protein 2

Alternate Names

BRAL1

Gene Symbol

HAPLN2

Additional HAPLN2 Products

Product Documents for HAPLN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HAPLN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAPLN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAPLN2 Antibody - BSA Free and earn rewards!

Have you used HAPLN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies