HDJ2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91453

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HDJ2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Dnaja1. Peptide sequence YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HDJ2 Antibody - BSA Free

Western Blot: HDJ2 Antibody [NBP1-91453]

Western Blot: HDJ2 Antibody [NBP1-91453]

Western Blot: HDJ2 Antibody [NBP1-91453] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Applications for HDJ2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HDJ2

HDJ 2 is a novel human homolog of E. coli's DNA J protein from heat shock protein 40 family. Hsp 40 is involved in chaperonic protein folding. HDJ-2 is cytoplasmic and nuclear membrane associated protein; upon heat shock it migrates and becomes associated with the golgi complex, nucleous and nuclear membrane. HDJ 2 has a prenylated C-terminus and is not inducible upon heat shock.

Alternate Names

DJ-2, DjA1, DnaJ (Hsp40) homolog, subfamily A, member 1, dnaJ homolog subfamily A member 1, DnaJ protein homolog 2, DNAJ2, HDJ2, hDj-2, Heat shock 40 kDa protein 4, Heat shock protein J2, heat shock protein, DNAJ-like 2, HSDJ, HSJ2, HSJ-2, HSPF4hdj-2, Human DnaJ protein 2, NEDD7, neural precursor cell expressed, developmentally down-regulated 7

Gene Symbol

DNAJA1

UniProt

NP_032324 (Mouse)

Additional HDJ2 Products

Product Documents for HDJ2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HDJ2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HDJ2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HDJ2 Antibody - BSA Free and earn rewards!

Have you used HDJ2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies