HEBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57944

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HEBP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYA

Reactivity Notes

Mouse 87%, Rat 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HEBP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HEBP1 Antibody [NBP2-57944]

Immunocytochemistry/ Immunofluorescence: HEBP1 Antibody [NBP2-57944]

Immunocytochemistry/Immunofluorescence: HEBP1 Antibody [NBP2-57944] - Staining of human cell line SK-MEL-30 shows localization to vesicles.

Applications for HEBP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HEBP1

HEBP1, also known as Heme-binding protein 1, is a 189 amino acid that is approx. 21 kDa, contains a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and stimulates calcium mobilization and chemotaxis in monocytes and dendritic cells; capable of binding free porphyrinogens and thus facilitates removal of these potentially toxic compound; heme or porphyrins; metalloporphyrins, free porphyrins and N-methylprotoporphyrin. Disease research has been performed on the relationship of this protein to ankylosis, root resorption, dental enamel hypoplasia, rickets, and breast cancer. The protein has been linked to the GPCR downstream signaling, peptide ligand-binding receptors, formyl peptide receptors bind formyl peptides and many other ligands, signal transduction, and signaling by GPCR pathways where interacts with over 100 proteins including GOT1, KCNMA1, FPR1, FPR2, and FPR3.

Alternate Names

HBPHEBP, heme binding protein 1, heme-binding protein 1, p22HBP

Gene Symbol

HEBP1

Additional HEBP1 Products

Product Documents for HEBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HEBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HEBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HEBP1 Antibody - BSA Free and earn rewards!

Have you used HEBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies