HEMK1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-81020PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all HEMK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEMK1.

Source: E. coli

Amino Acid Sequence: QYILGEWDFQGLSLRMVPPVFIPRPETEELVEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81020.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-81020PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HEMK1

HEMK1, also known as HemK methyltransferase family member 1, is a 338 amino acid that is 38 kDa; as methyltransferase transferase plays role in the methylation of the GGQ triplet of the mitochondrial translation release factor MTRF1L. This protein is being studied for its involvement in yersinia pseudotuberculosis, infectious disease, neisseria, meningitides, pneumonia, and tuberculosis. The HEMK1 protein has been linked to histidine metabolism and tyrosine metabolism pathways where it interacts with MTRF1, MTRF1L, MAT1A, MAT2A, and AHCY proteins.

Alternate Names

EC 2.1.1.-, FLJ22320, HEMK, HEMK homolog 7kb, HemK methyltransferase family member 1, M.HsaHemKP, MTQ1

Gene Symbol

HEMK1

Additional HEMK1 Products

Product Documents for HEMK1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HEMK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for HEMK1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review HEMK1 Recombinant Protein Antigen and earn rewards!

Have you used HEMK1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes