Hemoglobin epsilon Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84061

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Hemoglobin epsilon Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Hemoglobin epsilon. Peptide sequence: AVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Hemoglobin epsilon Antibody - BSA Free

Western Blot: Hemoglobin epsilon Antibody [NBP2-84061]

Western Blot: Hemoglobin epsilon Antibody [NBP2-84061]

Western Blot: Hemoglobin epsilon Antibody [NBP2-84061] - WB Suggested Anti-HBE antibody Titration: 1 ug/mL. Sample Type: Human Stomach Tumor

Applications for Hemoglobin epsilon Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hemoglobin epsilon

The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with twozeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together withtwo alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal,and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in thefollowing order: 5'-epsilon - G-gamma - A-gamma - delta - beta-3' (provided by RefSeq)

Alternate Names

epsilon globin, Epsilon-globin, HBEepsilon-globin, Hemoglobin epsilon chain, hemoglobin subunit epsilon, hemoglobin, epsilon 1

Gene Symbol

HBE1

Additional Hemoglobin epsilon Products

Product Documents for Hemoglobin epsilon Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hemoglobin epsilon Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hemoglobin epsilon Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hemoglobin epsilon Antibody - BSA Free and earn rewards!

Have you used Hemoglobin epsilon Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies