Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58058

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HS3ST1(heparan sulfate (glucosamine) 3-O-sulfotransferase 1) The peptide sequence was selected from the middle region of HS3ST1. Peptide sequence TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free

Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-58058]

Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-58058]

Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-58058] - Titration: 0.2-1 ug/ml, Positive Control: Human Stomach.

Applications for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1

HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.

Alternate Names

3OST1, h3-OST-1

Gene Symbol

HS3ST1

UniProt

O14792

Additional Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Products

Product Documents for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free and earn rewards!

Have you used Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Articular Cartilage Extracellular Matrix Articular Cartilage Extracellular Matrix Thumbnail