HERC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55025

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HERC6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HERC6(hect domain and RLD 6) Antibody(against the N terminal of HERC6. Peptide sequence LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HERC6 Antibody - BSA Free

Western Blot: HERC6 Antibody [NBP1-55025]

Western Blot: HERC6 Antibody [NBP1-55025]

Western Blot: HERC6 Antibody [NBP1-55025] - Positive Control: ACHN cell lysate.
Western Blot: HERC6 Antibody [NBP1-55025]

Western Blot: HERC6 Antibody [NBP1-55025]

Western Blot: HERC6 Antibody [NBP1-55025] - HEK293 cell lysate. Antibody at 1:1000.

Applications for HERC6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 4 using NBP1-55025 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HERC6

HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).

Alternate Names

EC 6.3.2, EC 6.3.2.-, FLJ20637, HECT domain and RCC1-like domain-containing protein 6, hect domain and RLD 6, potential ubiquitin ligase, probable E3 ubiquitin-protein ligase HERC6

Gene Symbol

HERC6

UniProt

Q8IVU3 (Human)

Additional HERC6 Products

Product Documents for HERC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HERC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HERC6 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used HERC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • HERC6 Antibody
    Name: Xin Leong
    Application: Western Blot
    Sample Tested: A549 whole cell lysate
    Species: Human
    Verified Customer | Posted 03/19/2021
    Five A549 total cell lysates of treated vs non-treated cells
    HERC6 Antibody - BSA Free NBP1-55025

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies