HERV Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86666

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HERV. Peptide sequence: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HERV Antibody - BSA Free

Western Blot: HERV Antibody [NBP2-86666]

Western Blot: HERV Antibody [NBP2-86666]

Western Blot: HERV Antibody [NBP2-86666] - Host: Rabbit. Target Name: ERVW-1. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml
Western Blot: HERV Antibody [NBP2-86666]

Western Blot: HERV Antibody [NBP2-86666]

Western Blot: HERV Antibody [NBP2-86666] - Host: Rabbit. Target: ERVW-1. Positive control (+): Human Placenta (PL). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml

Applications for HERV Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HERV

HERVs are a class of multiple sclerosis associated retroviruses. Reacts with a replication competent Human Endogenous Retrovirus (HERVW) isolated from placenta. The synthetic peptide sequence used as immunogen is taken from the virus envelope polyprotein sequence. Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. The HERVW endogenous envelope protein has retained its original fusogenic properties and participates in trophoblast fusion during placenta morphogenesis.

Alternate Names

endogenous retroviral family W, env(C7), member 1, ENV, envelope glycoprotein, Envelope polyprotein gPr73, enverin, ENVW, env-W, HERV7Q, HERV-7q, HERV-7q Envelope protein, HERV-tryptophan envelope protein, HERV-W, HERV-W Env glycoprotein, HERV-W envelope protein, HERV-W_7q21.2 provirus ancestral Env polyprotein, HERV-W{7q21.1} provirus ancestral Env polyprotein, HERVWENV, HERV-W-ENV, HERVWenvelope protein, human endogenous retrovirus W envC7-1 envelope protein, Syncytin, syncytin A, Syncytin-1

Gene Symbol

ERVW-1

Additional HERV Products

Product Documents for HERV Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HERV Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HERV Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HERV Antibody - BSA Free and earn rewards!

Have you used HERV Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...