Histone H2AY/macroH2A.1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53003

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to H2AFY(H2A histone family, member Y) The peptide sequence was selected from the N terminal of H2AFY. Peptide sequence HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Histone H2AY/macroH2A.1 Antibody - BSA Free

Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003]

Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003]

Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF7, Antibody Dilution: 1.0 ug/ml H2AFY is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003]

Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003]

Western Blot: Histone H2AY/macroH2A.1 Antibody [NBP1-53003] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for Histone H2AY/macroH2A.1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Histone H2AY

macroH2A.1 (H2AFY) is 372 amino acids long, weighs approximately 40 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. macroH2a.1 has two shorter isoforms meeasuring 371 and 369 amino acids long, both weighing approximately 39 kDa. Current studies are being done on several diseases and disorders including medulloblastoma, lupus erythematosus, Huntington's disease, immunodeficiency, melanoma, and malaria. macroH2A.1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the chromatin regulation/ acetylation, systemic lupus erythematosus, and ATF-2 transcription factor pathways.

Long Name

H2A Histone Family, Member Y

Alternate Names

H2AF12M, H2AFJ, H2AFY, Histone MacroH2A1, Medulloblastoma Antigen MU-MB-50.205

Gene Symbol

MACROH2A1

UniProt

Additional Histone H2AY Products

Product Documents for Histone H2AY/macroH2A.1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone H2AY/macroH2A.1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Histone H2AY/macroH2A.1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Histone H2AY/macroH2A.1 Antibody - BSA Free and earn rewards!

Have you used Histone H2AY/macroH2A.1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...