HLA C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86667

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HLA-C Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the HLA C-terminal region of HLA C. Peptide sequence: PPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit HLA C Antibody - BSA Free (NBP2-86667) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HLA C Antibody - BSA Free

Western Blot: HLA C Antibody [NBP2-86667]

Western Blot: HLA C Antibody [NBP2-86667]

Western Blot: HLA C Antibody [NBP2-86667] - WB Suggested Anti-HLA-C Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole Cell

Applications for HLA C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA-C

HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq]

Long Name

Major Histocompatibility Complex, Class I, C

Alternate Names

D6S204, HLA-JY3, HLAC, HLC-C

Gene Symbol

HLA-C

Additional HLA-C Products

Product Documents for HLA C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HLA C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HLA C Antibody - BSA Free and earn rewards!

Have you used HLA C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies