HLA DQ3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84068

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HLA DQ3. Peptide sequence: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HLA DQ3 Antibody - BSA Free

Western Blot: HLA DQ3 Antibody [NBP2-84068]

Western Blot: HLA DQ3 Antibody [NBP2-84068]

Western Blot: HLA DQ3 Antibody [NBP2-84068] - Host: Rabbit. Target Name: HLA-DQA1. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for HLA DQ3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HLA DQ3

Human Leukocyte Antigens are highly polymorphic proteins that are involved in the presentation of antigens to the T cell receptor. There are two classes of HLA antigens, class I (HLA A, HLA B and HLA C) and class II (HLA D). This antibody can be used for HLA typing.

Alternate Names

CD, CELIAC1DQ alpha 1 chain, DC-1 alpha chain, DQ-A1, FLJ27088, FLJ27328, GSE, HLA class II histocompatibility antigen, DQ(W3) alpha chain, HLA-DCA, HLA-DQA, leucocyte antigen DQA1, leukocyte antigen alpha chain, major histocompatibility complex, class II, DQ alpha 1, MGC149527, MHC class II antigen, MHC class II DQA1, MHC class II HLA-D alpha glycoprotein, MHC class II HLA-DQ-alpha-1, MHC class II surface glycoprotein, MHC HLA-DQ alpha

Gene Symbol

HLA-DQA1

Additional HLA DQ3 Products

Product Documents for HLA DQ3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HLA DQ3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA DQ3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HLA DQ3 Antibody - BSA Free and earn rewards!

Have you used HLA DQ3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...