HOXA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-04877

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HOXA10 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 236-336 of human HOXA10 (NP_061824.3). LGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXA10 Antibody - BSA Free

Western Blot: HOXA10 AntibodyBSA Free [NBP3-04877]

Western Blot: HOXA10 AntibodyBSA Free [NBP3-04877]

Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of various cell lines, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Western Blot: HOXA10 AntibodyBSA Free [NBP3-04877]

Western Blot: HOXA10 AntibodyBSA Free [NBP3-04877]

Western Blot: HOXA10 Antibody [NBP3-04877] - Analysis of extracts of Mouse kidney, using HOxA10 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit

Applications for HOXA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HOXA10

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters namedA, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated duringembryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcriptionfactor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function infertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcriptvariants encoding different isoforms have been described. (provided by RefSeq)

Alternate Names

homeo box A10, homeobox A10, homeobox protein 1H, Homeobox protein Hox-1.8, Homeobox protein Hox-1H, homeobox protein HOXA10, homeobox protein Hox-A10, HOX1, HOX1HHOX1.8, MGC12859, PL

Gene Symbol

HOXA10

Additional HOXA10 Products

Product Documents for HOXA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOXA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXA10 Antibody - BSA Free and earn rewards!

Have you used HOXA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies