HOXB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83055

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HOXB2. Peptide sequence: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOXB2 Antibody - BSA Free

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: 721_B. Antibody Dilution: 1.0ug/ml
Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055] - WB Suggested Anti-HOXB2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate
Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: Jurkat. Antibody Dilution: 1.0ug/ml
Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: MCF7. Antibody Dilution: 1.0ug/ml
Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055]

Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: Hela. Antibody Dilution: 1.0ug/ml

Applications for HOXB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXB2

The HOXB2 gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio

Alternate Names

homeo box 2H, homeo box B2, homeobox B2, Homeobox protein Hox-2.8, Homeobox protein Hox-2H, homeobox protein Hox-B2, HOX2, HOX2HHox-2.8, K8, K8 home protein

Gene Symbol

HOXB2

Additional HOXB2 Products

Product Documents for HOXB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXB2 Antibody - BSA Free and earn rewards!

Have you used HOXB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...