HOXB2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15962

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 50-140 of human HOXB2 (NP_002136.1). EQTFPSLQPGASTLQRPRSQKRAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXB2 Antibody - Azide and BSA Free

Western Blot: HOXB2 AntibodyAzide and BSA Free [NBP3-15962]

Western Blot: HOXB2 AntibodyAzide and BSA Free [NBP3-15962]

Western Blot: HOXB2 Antibody [NBP3-15962] - Western blot analysis of extracts of Mouse kidney, using HOXB2 antibody (NBP3-15962) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for HOXB2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HOXB2

The HOXB2 gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio

Alternate Names

homeo box 2H, homeo box B2, homeobox B2, Homeobox protein Hox-2.8, Homeobox protein Hox-2H, homeobox protein Hox-B2, HOX2, HOX2HHox-2.8, K8, K8 home protein

Gene Symbol

HOXB2

Additional HOXB2 Products

Product Documents for HOXB2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for HOXB2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HOXB2 Antibody - Azide and BSA Free and earn rewards!

Have you used HOXB2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...