Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-16060

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

HCoV-HKU1

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Human Coronavirus Nucleocapsid Protein Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus Nucleoprotein (YP_173242.1). WYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free

Western Blot: Human Coronavirus Nucleocapsid Protein AntibodyAzide and BSA Free [NBP3-16060]

Western Blot: Human Coronavirus Nucleocapsid Protein AntibodyAzide and BSA Free [NBP3-16060]

Western Blot: Human Coronavirus Nucleocapsid Protein Antibody [NBP3-16060] - Western blot analysis of extracts of Human coronavirus (HCoV-HKU1) Nucleocapsid Protein (His Tag), using Human Coronavirus Nucleocapsid Protein antibody (NBP3-16060) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Product Documents for Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free and earn rewards!

Have you used Human Coronavirus Nucleocapsid Protein Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies