ICAP-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57261

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (95%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ICAP-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ICAP-1 Antibody - BSA Free

Western Blot: ICAP-1 Antibody [NBP2-57261]

Western Blot: ICAP-1 Antibody [NBP2-57261]

Western Blot: ICAP-1 Antibody [NBP2-57261] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ICAP-1 Antibody [NBP2-57261]

Immunocytochemistry/ Immunofluorescence: ICAP-1 Antibody [NBP2-57261]

Immunocytochemistry/Immunofluorescence: ICAP-1 Antibody [NBP2-57261] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.

Applications for ICAP-1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ICAP-1

The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein are derived from alternatively spliced transcripts. The shorter form of this protein does not interact with the beta1 integrin cytoplasmic domain. The longer form is a phosphoprotein and the extent of its phosphorylation is regulated by the cell-matrix interaction, suggesting an important role of this protein during integrin-dependent cell adhesion.

Long Name

Integrin Cytoplasmic Domain-associated Protein 1

Alternate Names

Bodenin, ICAP1, ITGB1BP1

Gene Symbol

ITGB1BP1

Additional ICAP-1 Products

Product Documents for ICAP-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ICAP-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Customer Reviews for ICAP-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ICAP-1 Antibody - BSA Free and earn rewards!

Have you used ICAP-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies