ILT4/CD85d/LILRB2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98554

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LILRB2/CD85d/ILT4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is LILRB2 - C-terminal region. Peptide sequence MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ILT4/CD85d/LILRB2 Antibody - BSA Free

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554] - Host: Rabbit. Target: LILRB2. Positive control (+): Human brain (BR). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml
Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554] - Human Fetal Brain Lysate 1.0ug/ml, Gel Concentration: 12%
Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554]

Western Blot: ILT4/CD85d/LILRB2 Antibody [NBP1-98554] - Host: Rabbit. Target Name: LILRB2. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for ILT4/CD85d/LILRB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LILRB2/CD85d/ILT4

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

Long Name

Leukocyte Immunoglobulin-like Receptor, Subfamily B (with TM and ITIM Domains), Member 5

Alternate Names

CD85d, ILT4, LIR2, MIR10

Gene Symbol

LILRB2

UniProt

NP_005865

Additional LILRB2/CD85d/ILT4 Products

Product Documents for ILT4/CD85d/LILRB2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ILT4/CD85d/LILRB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILT4/CD85d/LILRB2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ILT4/CD85d/LILRB2 Antibody - BSA Free and earn rewards!

Have you used ILT4/CD85d/LILRB2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies