Importin alpha 2/KPNA2 Antibody (9T3V8)

Novus Biologicals | Catalog # NBP3-16530

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9T3V8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Importin alpha 2/KPNA2 (P52292). MSTNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Importin alpha 2/KPNA2 Antibody (9T3V8)

Western Blot: Importin alpha 2/KPNA2 Antibody (9T3V8) [NBP3-16530]

Western Blot: Importin alpha 2/KPNA2 Antibody (9T3V8) [NBP3-16530]

Western Blot: Importin alpha 2/KPNA2 Antibody (9T3V8) [NBP3-16530] - Western blot analysis of extracts of various cell lines, using Importin alpha 2/KPNA2 Rabbit mAb (NBP3-16530) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for Importin alpha 2/KPNA2 Antibody (9T3V8)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Importin alpha 2/KPNA2

The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination

Long Name

Karyopherin alpha 2

Alternate Names

Importin alpha 1, IPOA1, KPNA2, Pendulin, QIP2, RCH1, SRP1-alpha

Gene Symbol

KPNA2

Additional Importin alpha 2/KPNA2 Products

Product Documents for Importin alpha 2/KPNA2 Antibody (9T3V8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Importin alpha 2/KPNA2 Antibody (9T3V8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Importin alpha 2/KPNA2 Antibody (9T3V8)

There are currently no reviews for this product. Be the first to review Importin alpha 2/KPNA2 Antibody (9T3V8) and earn rewards!

Have you used Importin alpha 2/KPNA2 Antibody (9T3V8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...