Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-54604
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: alpha-1.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Jurkat, Antibody Dilution: 1.0 ug/ml.Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.Applications for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Importin alpha 5/KPNA1
Additional Importin alpha 5/KPNA1 Products
Product Documents for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free and earn rewards!
Have you used Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...