Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54604

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha-1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Jurkat, Antibody Dilution: 1.0 ug/ml.
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP1-54604] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Applications for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin alpha 5/KPNA1

Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. KPNA1 interacts with RAG1 and may play a role in V(D)J recombination.Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

IPOA5, KPNA1, NPI-1, RCH2, SRP1

Gene Symbol

KPNA1

UniProt

Additional Importin alpha 5/KPNA1 Products

Product Documents for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free and earn rewards!

Have you used Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...