ING1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57223

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ING1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ING1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ING1 Antibody [NBP2-57223]

Immunocytochemistry/ Immunofluorescence: ING1 Antibody [NBP2-57223]

Immunocytochemistry/Immunofluorescence: ING1 Antibody [NBP2-57223] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
ING1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: ING1 Antibody - BSA Free [NBP2-57223]

Chromatin Immunoprecipitation-exo-Seq: ING1 Antibody - BSA Free [NBP2-57223]

ChIP-Exo-Seq composite graph for Anti-ING1 (NBP2-57223) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for ING1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ING1

p33 ING1 is a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53-signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. The accession number listed below is for variant (4) that encodes the longest isoform (D). Other synonyms for p33 ING1 include p33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a, growth inhibitor ING1, inhibitor of growth 1, tumor suppressor ING1 and growth inhibitory protein ING1.

Long Name

Inhibitor of Growth 1

Alternate Names

p24ING1c, p33ING1b, p47ING1a

Gene Symbol

ING1

Additional ING1 Products

Product Documents for ING1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ING1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
p53 Pathway

Customer Reviews for ING1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ING1 Antibody - BSA Free and earn rewards!

Have you used ING1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies