INPP5A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38035

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all INPP5A Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-200 of human INPP5A (NP_005530.3).

Sequence:
TAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for INPP5A Antibody - BSA Free

INPP5A Antibody

Western Blot: INPP5A Antibody [NBP3-38035] -

Western Blot: INPP5A Antibody [NBP3-38035] - Western blot analysis of various lysates using INPP5A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for INPP5A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: INPP5A

INPP5A is a gene which codes for a protein that functions as a major isoenzyme that hydrolyzes the calcium-mobilizing second messenger Ins(1,4,5)P3 in a signal-terminating reaction and is comprised of 412 amino acids, with a mass of approximately 48 kDa. Studies are being conducted in several diseases and disorders relating to this gene including oculocerebrorenal syndrome, cutaneous T cell lymphoma, squamous cell carcinoma, Fanconi syndrome, schizophrenia, carcinoma, and olivopontocerebellar atrophy. INPP5A has also been shown to have interactions with PLEK, YWHAZ, GRB2, INPP1, and IPMK in pathways such as the inositol phosphate metabolism pathway.

Alternate Names

43 kDa inositol polyphosphate 5-phophatase, CTCL tumor antigen HD-CL-02,5PTASE, DKFZp434A1721, EC 3.1.3.56, inositol polyphosphate-5-phosphatase, 40kD, inositol polyphosphate-5-phosphatase, 40kDa, inositol trisphosphate-5-phosphatase, 40kD, InsP3 5-phosphatase, MGC116947,5PTase, MGC116949, type I inositol-14,5-trisphosphate 5-phophatase, type I inositol-14,5-trisphosphate 5-phosphatase

Gene Symbol

INPP5A

Additional INPP5A Products

Product Documents for INPP5A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INPP5A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INPP5A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INPP5A Antibody - BSA Free and earn rewards!

Have you used INPP5A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies