Insulin (human) recombinant
expressed in yeast

Catalog # Availability Size / Price Qty
3435/10
Insulin (human) recombinantexpressed in yeast
1 Image
Description: Endogenous peptide agonist
Product Details
Citations (3)
Reviews

Biological Activity

Endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.

Technical Data

M.Wt:
5807.57
Formula:
C257H383N65O77S6
Sequence:
GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

(Modifications: Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*)

Solubility:
Soluble to 20 mg/ml in 0.01 M hydrochloric acid
Storage:
Store at -20°C
CAS No:
11061-68-0

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Background References

  1. Age dependent changes of Ins receptors in rat tissues.
    Torlinska et al.
    J.Physiol.Pharmacol., 2000;51:871
  2. The binding characteristics of Ins-MTX to Ins receptor.
    Ou et al.
    Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao., 2001;32:538
  3. The molecular basis of Ins-stimulated glucose uptake: signalling, trafficking and potential drug targets.
    Leney and Tavare
    J.Endocrinol., 2009;203:1

Product Datasheets

or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citations for Insulin (human) recombinant
expressed in yeast

The citations listed below are publications that use Tocris products. Selected citations for Insulin (human) recombinant
expressed in yeast include:

3 Citations: Showing 1 - 3

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Insulin (human) recombinant
expressed in yeast

There are currently no reviews for this product. Be the first to review Insulin (human) recombinant
expressed in yeast
and earn rewards!

Have you used Insulin (human) recombinant
expressed in yeast?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.