Catalog Number: 3435
Biological Activity
Endogenous insulin receptor agonist (Ki = 4.85 nM). Decreases plasma glucose levels, proteolysis, lipolysis and gluconeogenesis and increases glycogen and fatty acid synthesis in vivo.
Technical Data
  • M.Wt:
    5807.57
  • Formula:
    C257H383N65O77S6
  • Sequence:
    GIVEQCCTSICSLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKT*

    (Modifications: Disulfide bridge between 6 - 11, 7 -7*, 20 - 19*)

  • Solubility:
    Soluble to 20 mg/ml in 0.01 M hydrochloric acid
  • Storage:
    Store at -20°C
  • CAS No:
    11061-68-0
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Age dependent changes of insulin receptors in rat tissues.
    Torlinska et al.
    J.Physiol.Pharmacol., 2000;51:871
  2. The binding characteristics of insulin-MTX to insulin receptor.
    Ou et al.
    Hua.Xi.Yi.Ke.Da.Xue.Xue.Bao., 2001;32:538
  3. The molecular basis of insulin-stimulated glucose uptake: signalling, trafficking and potential drug targets.
    Leney and Tavare
    J.Endocrinol., 2009;203:1
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Insulin (human) recombinant
expressed in yeast include:

1 Citations: Showing 1 - 1

  1. GSK3-mediated raptor phosphorylation supports amino-acid-dependent mTORC1-directed signalling.
    Authors: Stretton Et al.
    Br J Pharmacol 2015;470:207

Have you used Insulin (human) recombinant
expressed in yeast?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information