Integrin alpha 6/CD49f Antibody (2R5F1)

Novus Biologicals | Catalog # NBP3-15646

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Flow Cytometry

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2R5F1 expressed in HEK293
View all Integrin alpha 6/CD49f Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 481-591 of human Integrin alpha 6/CD49f (NP_001073286.1). IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin alpha 6/CD49f Antibody (2R5F1)

Western Blot: Integrin alpha 6/CD49f Antibody (2R5F1) [NBP3-15646]

Western Blot: Integrin alpha 6/CD49f Antibody (2R5F1) [NBP3-15646]

Western Blot: Integrin alpha 6/CD49f Antibody (4E4K6) [NBP3-15646] - Western blot analysis of extracts of A-431 cells, using Integrin alpha 6/CD49f (ITGA6/CD49f) antibody (NBP3-15646) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for Integrin alpha 6/CD49f Antibody (2R5F1)

Application
Recommended Usage

Flow Cytometry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 6/CD49f

The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Alternate Names

CD49f, ITGA6, Platelet gpl, VLA-6

Gene Symbol

ITGA6

Additional Integrin alpha 6/CD49f Products

Product Documents for Integrin alpha 6/CD49f Antibody (2R5F1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Integrin alpha 6/CD49f Antibody (2R5F1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin alpha 6/CD49f Antibody (2R5F1)

There are currently no reviews for this product. Be the first to review Integrin alpha 6/CD49f Antibody (2R5F1) and earn rewards!

Have you used Integrin alpha 6/CD49f Antibody (2R5F1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies