Integrin alpha 6/CD49f Antibody (7U5Z0)

Name: Integrin alpha 6/CD49f Antibody (7U5Z0)
Brand: Novus Biologicals
SKU: NBP3-16085
Price: 419 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-16085

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7U5Z0 expressed in HEK293

View all Integrin alpha 6/CD49f Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 481-591 of human Integrin alpha 6/CD49f (NP_001073286.1). IDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Integrin alpha 6/CD49f Antibody (7U5Z0) (NBP3-16085) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Integrin alpha 6/CD49f Antibody (7U5Z0)

Western Blot: Integrin alpha 6/CD49f Antibody (7U5Z0) [NBP3-16085]

Western Blot: Integrin alpha 6/CD49f Antibody (2R5F1) [NBP3-16085] - Western blot analysis of extracts of various cell lines, using Integrin alpha 6/CD49f antibody (NBP3-16085) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Western Blot: Integrin alpha 6/CD49f Antibody (7U5Z0) [NBP3-16085]

Applications for Integrin alpha 6/CD49f Antibody (7U5Z0)

Application

Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 6/CD49f

The ITGA6 protein product is the integrin alpha chain alpha 6. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. For example, alpha 6 may combine with beta 4 in the integrin referred to as TSP180, or with beta 1 in the integrin VLA-6. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Alternate Names

CD49f, ITGA6, Platelet gpl, VLA-6

Gene Symbol

ITGA6

Additional Integrin alpha 6/CD49f Products

Product Documents for Integrin alpha 6/CD49f Antibody (7U5Z0)

Download Product Datasheets

Download SDS

Product Specific Notices for Integrin alpha 6/CD49f Antibody (7U5Z0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.