IRF2BP2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-93674
![Western Blot: IRF2BP2 Antibody [NBP1-93674]](https://resources.rndsystems.com/images/products/IRF2BP2-Antibody-Western-Blot-NBP1-93674-img0014.jpg "Western Blot: IRF2BP2 Antibody [NBP1-93674]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDWVNRPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPSPEPEGEVG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for IRF2BP2 Antibody - BSA Free
Western Blot: IRF2BP2 Antibody [NBP1-93674]
Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in mouse cell line NIH-3T3 and rat cell ine NBT-II.![Western Blot: IRF2BP2 Antibody [NBP1-93674]](https://resources.rndsystems.com/images/products/IRF2BP2-Antibody-Western-Blot-NBP1-93674-img0010.jpg "Western Blot: IRF2BP2 Antibody [NBP1-93674]")
Western Blot: IRF2BP2 Antibody [NBP1-93674]
Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in human cell line THP-1.![IRF2BP2 Antibody - BSA Free Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-3052025749520.jpg "Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.![IRF2BP2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-3052025749517.jpg "Immunocytochemistry/ Immunofluorescence: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Immunocytochemistry/ Immunofluorescence: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Staining of human cell line U-2 OS shows localization to nucleus.![IRF2BP2 Antibody - BSA Free Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-3052025107455.jpg "Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Western Blot: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Analysis in human cell line THP-1.![IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-30520257234214.jpg "Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Staining of human prostate shows strong nuclear positivity in glandular cells.![IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-305202510125912.jpg "Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Staining of human colon shows strong nuclear positivity in glandular cells.![IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-29520251618423.jpg "Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Staining of human endometrium shows moderate nuclear positivity in glandular cells.![IRF2BP2 Antibody - BSA Free Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]](https://resources.rndsystems.com/images/products/nbp1-93674_rabbit-polyclonal-irf2bp2-antibody-29520251624315.jpg "Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]")
Immunohistochemistry: IRF2BP2 Antibody - BSA Free [NBP1-93674]
Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.Applications for IRF2BP2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: IRF2BP2
Alternate Names
interferon regulatory factor 2 binding protein 2, IRF-2-binding protein 2
Gene Symbol
IRF2BP2
Additional IRF2BP2 Products
Product Documents for IRF2BP2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for IRF2BP2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for IRF2BP2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review IRF2BP2 Antibody - BSA Free and earn rewards!
Have you used IRF2BP2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...