IRP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10538

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all IRP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IRP2 (NP_004127). Peptide sequence IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

105 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IRP2 Antibody - BSA Free

Western Blot: IRP2 Antibody [NBP3-10538]

Western Blot: IRP2 Antibody [NBP3-10538]

Western Blot: IRP2 Antibody [NBP3-10538] - Host: Rabbit. Target Name: IRP2. Sample Tissue: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

Applications for IRP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IRP2

Iron regulatory protein 2 (IRP2) is a central post-transcriptional regulator of cellular and systemic iron metabolism. It is a cytosolic RNA-binding protein that binds to stem-loop structures. IRP2 is regulated by iron-mediated proteolysis. IRP2 also plays a role during hypoxia, as iron and oxygen are closely related.

Alternate Names

ACO3, EC 4.2.1.3, FLJ23381, IRE-BP 2, Iron regulatory protein 2, iron-responsive element binding protein 2, iron-responsive element-binding protein 2, IRP2IRP2AD

Gene Symbol

IREB2

Additional IRP2 Products

Product Documents for IRP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IRP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IRP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IRP2 Antibody - BSA Free and earn rewards!

Have you used IRP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies