Jak2 Recombinant Protein Antigen

Name: Jak2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38476PEP
Price: 279 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-38476PEP

Submit a review

Product Documents

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

E. coli

Applications

Antibody Competition

View all Jak2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human JAK2.

Source: E. coli

Amino Acid Sequence: VPVTHETQEECLGMAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQFSQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38476.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-38476PEP

Formulation	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20C. Avoid freeze-thaw cycles.

Background: Jak2

Jak2 is a member of the Janus family tyrosine kinases (Jaks), whose function is to transduce extracellular signals from cytokines and interferons. Jaks associate with cytokine receptors; upon ligand binding, Jaks phosphorylate the receptor. The phosphorylated receptors are bound by SH2-containing proteins, one class of which is the signal transducers and activators of transcription (STATs). Activated STATs, then, translocate to the nucleus to mediate gene transcription (1,2). Tyr1007/1008 of Jak2 are the homologous Tyr1054/1055 in Tyk2, and phosphorylation at these residues is needed for Tyk2 activation (3). A chromosomal aberration involving Jak2 is found in a form of pre-B acute myeloid leukemia (4).

Long Name

Janus Kinase 2

Alternate Names

EC 2.7.10, EC 2.7.10.2, JAK-2, Janus kinase 2Janus kinase 2 (a protein tyrosine kinase), JTK10, tyrosine-protein kinase JAK2

Gene Symbol

JAK2

Additional Jak2 Products

Product Documents for Jak2 Recombinant Protein Antigen

Download Product Datasheets

Download Antigen Blocking Protocol

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Jak2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.