Jingzhaotoxin III

Catalog # Availability Size / Price Qty
4913/100U
Jingzhaotoxin III
1 Image
Description: Selective NaV1.5 channel blocker
Product Details
Reviews

Biological Activity

Selective blocker of NaV1.5 channels (IC50 = 348 nM); displays no effect on other isoforms, including NaV1.2, NaV1.4, NaV1.6 and NaV1.7. Thought to inhibit sodium channel activation by binding to the NaV1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.

Technical Data

Formula:
C174H241N47O46S6
Sequence:
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

(Modifications: Disulfide bridge: 4-19,11-24,18-31)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
925463-91-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

or select another batch:
Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Jingzhaotoxin III

There are currently no reviews for this product. Be the first to review Jingzhaotoxin III and earn rewards!

Have you used Jingzhaotoxin III?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.