Catalog Number: 4913
Biological Activity
Selective blocker of NaV1.5 channels (IC50 = 348 nM); displays no effect on other isoforms, including NaV1.2, NaV1.4, NaV1.6 and NaV1.7. Thought to inhibit sodium channel activation by binding to the NaV1.5 S3-S4 linker of domain II. Selectively inhibits the activation of cardiac sodium channels, but has no effect on sodium channels in dorsal root ganglion neurons.
Technical Data
  • Formula:
    C174H241N47O46S6
  • Sequence:
    DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

    (Modifications: Disulfide bridge: 4-19,11-24,18-31)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    925463-91-8
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Jingzhaotoxin-III, a novel spider toxin inhibiting activation of sodium channel in rat cardiac myocytes.
    Xiao et al.
    J.Biol.Chem., 2004;279:26220
  2. Molecular basis of the tarantula toxin jingzhaotoxin-III (β-TRTX-Cj1α) interacting with voltage sensors in sodium channel subtype Nav1.5.
    Rong et al.
    FASEB J., 2011;25:3177

Have you used Jingzhaotoxin III?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information