JIP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89638

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all JIP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for JIP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638] - Staining of human Pancreas shows moderate cytoplasmic positivity in islets of Langerhans and exocrine glandular cells.
Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638] - Staining of human Cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638]

Immunohistochemistry-Paraffin: JIP2 Antibody [NBP1-89638] - Staining of human Testis shows moderate cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Applications for JIP2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JIP2

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites, Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members have been identified as JNK2 and JNK3. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.

Alternate Names

C-Jun-amino-terminal kinase-interacting protein 2, homologous to mouse JIP-1, IB-2, IB2JIP2Mitogen-activated protein kinase 8-interacting protein 2, islet-brain 2, islet-brain-2, JIP-2, JNK MAP kinase scaffold protein 2, JNK MAP kinase scaffold protein JIP2, JNK-interacting protein 2, mitogen-activated protein kinase 8 interacting protein 2, PRKM8 interacting protein-like, PRKM8IPL

Gene Symbol

MAPK8IP2

Additional JIP2 Products

Product Documents for JIP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for JIP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for JIP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review JIP2 Antibody - BSA Free and earn rewards!

Have you used JIP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies