KIFC1 Antibody (10M10J4)
Novus Biologicals | Catalog # NBP3-15248
Recombinant Monoclonal Antibody
![Western Blot: KIFC1 Antibody (10M10J4) [NBP3-15248]](https://resources.rndsystems.com/images/products/KIFC1-Antibody-10M10J4-Western-Blot-NBP3-15248-img0004.jpg "Western Blot: KIFC1 Antibody (10M10J4) [NBP3-15248]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10M10J4 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIFC1 (Q9BW19). MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for KIFC1 Antibody (10M10J4)
Western Blot: KIFC1 Antibody (10M10J4) [NBP3-15248]
Western Blot: KIFC1 Antibody (10M10J4) [NBP3-15248] - Western blot analysis of extracts of various cell lines, using KIFC1 antibody (NBP3-15248) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.![Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248]](https://resources.rndsystems.com/images/products/KIFC1-Antibody-10M10J4-Immunocytochemistry-Immunofluorescence-NBP3-15248-img0003.jpg "Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248]")
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248]
Immunocytochemistry/Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248] - Immunofluorescence analysis of U-2 OS cells using KIFC1 Rabbit mAb (NBP3-15248) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.![Immunohistochemistry-Paraffin: KIFC1 Antibody (10M10J4) [NBP3-15248]](https://resources.rndsystems.com/images/products/KIFC1-Antibody-10M10J4-Immunohistochemistry-Paraffin-NBP3-15248-img0001.jpg "Immunohistochemistry-Paraffin: KIFC1 Antibody (10M10J4) [NBP3-15248]")
Immunohistochemistry-Paraffin: KIFC1 Antibody (10M10J4) [NBP3-15248]
Immunohistochemistry-Paraffin: KIFC1 Antibody (10M10J4) [NBP3-15248] - Immunohistochemistry of paraffin-embedded human appendix using KIFC1 Rabbit mAb (NBP3-15248) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.![Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248]](https://resources.rndsystems.com/images/products/KIFC1-Antibody-10M10J4-Immunocytochemistry-Immunofluorescence-NBP3-15248-img0002.jpg "Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248]")
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248]
Immunocytochemistry/Immunofluorescence: KIFC1 Antibody (10M10J4) [NBP3-15248] - Immunofluorescence analysis of NIH-3T3 cells using KIFC1 Rabbit mAb (NBP3-15248) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [KIFC1] -
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [KIFC1] - Immunofluorescence analysis of NIH-3T3 cells using KIFC1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [KIFC1] -
Immunocytochemistry/ Immunofluorescence: KIFC1 Antibody (10M10J4) [KIFC1] - Immunofluorescence analysis of U-2 OS cells using KIFC1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for KIFC1 Antibody (10M10J4)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: KIFC1
Alternate Names
HSETMGC1202, kinesin family member C1, kinesin-like 2, Kinesin-like protein 2, kinesin-like protein KIFC1, Kinesin-related protein HSET, KNSL2MGC149736, MGC149737
Gene Symbol
KIFC1
Additional KIFC1 Products
Product Documents for KIFC1 Antibody (10M10J4)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for KIFC1 Antibody (10M10J4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for KIFC1 Antibody (10M10J4)
There are currently no reviews for this product. Be the first to review KIFC1 Antibody (10M10J4) and earn rewards!
Have you used KIFC1 Antibody (10M10J4)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...