Kininogen 1 Antibody (8O3B3)

Novus Biologicals | Catalog # NBP3-15417

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8O3B3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (NP_001095886.1). PTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kininogen 1 Antibody (8O3B3)

Western Blot: Kininogen 1 Antibody (8O3B3) [NBP3-15417]

Western Blot: Kininogen 1 Antibody (8O3B3) [NBP3-15417]

Western Blot: Kininogen 1 Antibody (8O3B3) [NBP3-15417] - Western blot analysis of extracts of various cell lines, using Kininogen 1 (KNG1) Rabbit mAb (NBP3-15417) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Kininogen 1 Antibody (8O3B3) [NBP3-15417]

Western Blot: Kininogen 1 Antibody (8O3B3) [NBP3-15417]

Western Blot: Kininogen 1 Antibody (8O3B3) [NBP3-15417] - Western blot analysis of extracts of various cell lines, using Kininogen 1 (KNG1) Rabbit mAb (NBP3-15417) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Applications for Kininogen 1 Antibody (8O3B3)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Kininogen 1

Alternate Names

Alpha-2-thiol proteinase inhibitor, BDK, BK, bradykinin, Fitzgerald factor, High molecular weight kininogen, HMWK, kininogen-1, Williams-Fitzgerald-Flaujeac factor

Gene Symbol

KNG1

Additional Kininogen 1 Products

Product Documents for Kininogen 1 Antibody (8O3B3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kininogen 1 Antibody (8O3B3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kininogen 1 Antibody (8O3B3)

There are currently no reviews for this product. Be the first to review Kininogen 1 Antibody (8O3B3) and earn rewards!

Have you used Kininogen 1 Antibody (8O3B3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...