Recombinant Human KIST GST (N-Term) Protein

Name: Recombinant Human KIST GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00127933-P01
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # H00127933-P01

Submit a review

Citations (1)

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all KIST Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-344 of Human UHMK1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSATIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEGLC

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

64.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human KIST GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00127933-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: KIST

Upon serum stimulation, phosphorylates CDKN1B/p27Kip1, thus controlling CDKN1B subcellular location and cellcycle progression in G1 phase. May be involved in trafficking and/or processing of RNA

Alternate Names

DKFZp434C1613, EC 2.7.11.1, FLJ23015, kinase interacting with leukemia-associated gene (stathmin), Kinase interacting with stathmin, KISKIS protein kinase, KIST, serine/threonine-protein kinase Kist, U2AF homology motif (UHM) kinase 1, U2AF homology motif kinase 1

Gene Symbol

UHMK1

Additional KIST Products

Product Documents for Recombinant Human KIST GST (N-Term) Protein

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Recombinant Human KIST GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human KIST GST (N-Term) Protein

Customer Reviews for Recombinant Human KIST GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human KIST GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human KIST GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image