KMT1A/SUV39H1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82269

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KMT1A/SUV39H1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SUV39H1. Peptide sequence: RHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KMT1A/SUV39H1 Antibody - BSA Free

Western Blot: KMT1A/SUV39H1 Antibody [NBP2-82269]

Western Blot: KMT1A/SUV39H1 Antibody [NBP2-82269]

Western Blot: KMT1A/SUV39H1 Antibody [NBP2-82269] - WB Suggested Anti-SUV39H1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysateSUV39H1 is supported by BioGPS gene expression data to be expressed in 721_B

Applications for KMT1A/SUV39H1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KMT1A/SUV39H1

SUV39H1 (suppressor of variegation 3-9 homolog 1) is a histone methyltransferase that specifically trimethylates histone H3 at lys 9. Trimethylation stimulates the binding of heterochromatin proteins (HPs) which leads to epigenetic transcriptional repression in heterochromatin regions.

Long Name

Histone-lysine N-methyltransferase SUV39H1

Alternate Names

EC 2.1.1.355, H3-K9-HMTase 1, KMT1A, SUV39H, SUV39H1

Gene Symbol

SUV39H1

Additional KMT1A/SUV39H1 Products

Product Documents for KMT1A/SUV39H1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KMT1A/SUV39H1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KMT1A/SUV39H1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KMT1A/SUV39H1 Antibody - BSA Free and earn rewards!

Have you used KMT1A/SUV39H1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies