KRTCAP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14179

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KRTCAP3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: TLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KRTCAP3 Antibody - BSA Free

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179]

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179]

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179] - Staining in human colon and heart muscle tissues using anti-KRTCAP3 antibody. Corresponding KRTCAP3 RNA-seq data are presented for the same tissues.
Western Blot: KRTCAP3 Antibody [NBP2-14179]

Western Blot: KRTCAP3 Antibody [NBP2-14179]

Western Blot: KRTCAP3 Antibody [NBP2-14179] - Analysis in control (vector only transfected HEK293T lysate) and KRTCAP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179]

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179]

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179]

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179]

Immunohistochemistry-Paraffin: KRTCAP3 Antibody [NBP2-14179] - Staining of human heart muscle shows low expression as expected.

Applications for KRTCAP3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP2-14179 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KRTCAP3

Alternate Names

KCP3KCP-3, keratinocyte associated protein 3, keratinocyte-associated protein 3, keratinocytes associated protein 3, MGC126736, MGC126738, MRV222, PRO9898

Gene Symbol

KRTCAP3

Additional KRTCAP3 Products

Product Documents for KRTCAP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KRTCAP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KRTCAP3 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used KRTCAP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • KRTCAP3 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Frozen Rat Liver Tissue sections
    Species: Rat
    Verified Customer | Posted 01/03/2023
    GAPDH @ 1:1000 KCP3 @ 0.1 ug/mL Lanes 2, 5, 7, 9 : WT Liver samples Lanes 3, 4, 6, 8 : KO Liver samples Good Ab, but banding in KCP3 protein confirms the antibody is not reactive to rat protein
    Snap-frozen liver tissue, IP lysis buffer WT and KO rats (verified by qPCR) Blocked for 1 h, 1* Ab overnight, 2* Ab for 1 h 1* Ab were prepared in a 1% blocking buffer/TBST solution
    KRTCAP3 Antibody - BSA Free NBP2-14179
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies