Kv11.1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10366

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Kv11.1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Kv11.1 (NP_742054). Peptide sequence SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

90 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Kv11.1 Antibody - BSA Free

Western Blot: Kv11.1 Antibody [NBP3-10366]

Western Blot: Kv11.1 Antibody [NBP3-10366]

Western Blot: Kv11.1 Antibody [NBP3-10366] - Western blot analysis using NBP3-10366 on Human OVCAR-3 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for Kv11.1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv11.1

Human ether-a-go-go related gene (HERG) encodes the pore-forming subunit of the delayed rectifier potassium channel IKr. There are two N-terminal splice variants of HERG include the full-length isoform 1 alpha and the shorter isoform 1 beta. Isoform 1 beta lacks the PAS motif and deactivates at a faster rate than isoform 1alpha. Residues within the C-terminal play a role in channel expression and channel gating, including voltage-dependent activation. HERG is expressed in the heart and is more abundantly expressed in the ventricles than in the atria. Mutations in the gene encoding HERG increase beat-to-beat variability and early after depolarization. These fluctuations facilitate the genesis and propagation of premature heartbeats associated with inheritable long QT syndrome type 2 and short QT syndrome type 1.

Long Name

Potassium voltage-gated channel subfamily H member 2

Alternate Names

Eag homolog, ERG, ERG-1, ERG1, H-ERG, HERG, hERG-1, hERG1, KCNH2

Gene Symbol

KCNH2

Additional Kv11.1 Products

Product Documents for Kv11.1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv11.1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv11.1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv11.1 Antibody - BSA Free and earn rewards!

Have you used Kv11.1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies