Lipoprotein Lipase/LPL Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-58366PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all Lipoprotein Lipase/LPL Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lipoprotein Lipase/LPL.

Source: E. coli

Amino Acid Sequence: DQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58366.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-58366PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Lipoprotein Lipase/LPL

LPL, also known as Lipoprotein lipase, is a 475 amino acid that is 53 kDa, is a vascular lipase, but not synthesized in endothelial cells. It is anchored to the capillary endothelium by proteoglycans and acts as a catalyzer of triglycerides hydrolysis to release free fatty acids into the circulation and initiates the processing of triglyceride-rich lipoproteins such as chylomicrons and VLDL. It is being studied for its involvement in 150+ diseases and disorders including high density lipoprotein cholesterol level qtl 11, hyperlipoproteinemia, lipoprotein lipase deficiency, familial lipoprotein lipase deficiency, hyperlipoproteinemia type v, lipase deficiency combined, hyperlipoproteinemia type iii, glycogen storage disease, hyperlipidemia, hypertriglyceridemia, glucose intolerance, cetp deficiency, hypertension, fatty liver, nephrotic syndrome, kidney failure, and myocardial infarction. This protein has been shown to interact with 50 proteins including COPS6, PTPN4, RPL18A, ASCC2, KIAA1377 in developmental biology, transcriptional regulation of white adipocyte differentiation, lipid digestion, mobilization, and transport, metabolism, lipoprotein metabolism, glycerolipid metabolism, PPAR signaling pathway, and Alzheimer's disease pathways.

Alternate Names

LIPD, LPL

Gene Symbol

LPL

Additional Lipoprotein Lipase/LPL Products

Product Documents for Lipoprotein Lipase/LPL Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lipoprotein Lipase/LPL Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Lipoprotein Lipase/LPL Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Lipoprotein Lipase/LPL Recombinant Protein Antigen and earn rewards!

Have you used Lipoprotein Lipase/LPL Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes