LOXL4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-32692
![Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692]](https://resources.rndsystems.com/images/products/LOXL4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32692-img0007.jpg "Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692]")
Discontinued Product
NBP2-32692 has been discontinued.
View all LOXL4 products.
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Predicted:
Rat (91%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVEVKYEGHWRQVCDQGWTMN
Reactivity Notes
Use in Mouse reported in scientific publication (PMID: 32424143).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for LOXL4 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: LOXL4 Antibody [NBP2-32692]
Immunocytochemistry/Immunofluorescence: LOXL4 Antibody [NBP2-32692] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]](https://resources.rndsystems.com/images/products/LOXL4-Antibody-Immunohistochemistry-Paraffin-NBP2-32692-img0010.jpg "Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]")
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human kidney shows strong positivity in extracellular matrix of renal tubules.![Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]](https://resources.rndsystems.com/images/products/LOXL4-Antibody-Immunohistochemistry-Paraffin-NBP2-32692-img0008.jpg "Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]")
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human placenta shows strong positivity in extracellular matrix of the trophoblast.![Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]](https://resources.rndsystems.com/images/products/LOXL4-Antibody-Immunohistochemistry-Paraffin-NBP2-32692-img0009.jpg "Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]")
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human testis shows moderate to strong positivity in extracellular matrix of peritubular myoid cells.![Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]](https://resources.rndsystems.com/images/products/LOXL4-Antibody-Immunohistochemistry-Paraffin-NBP2-32692-img0011.jpg "Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]")
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692]
Immunohistochemistry-Paraffin: LOXL4 Antibody [NBP2-32692] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry: LOXL4 Antibody - BSA Free [NBP2-32692] -
Representative immunohistochemistry of LOXs in PDAC tissues and normal pancreas tissues. (A) IHC staining of LOX and quantification showed higher expression in PDAC than normal pancreas tissues. (B) IHC staining and quantification showed higher expression of LOXL1 in PDAC. (C) IHC staining and quantification showed higher expression of LOXL2 in PDAC. (D) IHC staining and quantification showed lower expression of LOXL3 in PDAC. (E) LOXL4 expression levels were similar in PDAC and normal tissues. *p < 0.01; NS, no significant difference. n = 6, repeated 5 times. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35433829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Immunohistochemistry: LOXL4 Antibody - BSA Free [NBP2-32692] -
Representative immunohistochemistry of LOXs in PDAC tissues and normal pancreas tissues. (A) IHC staining of LOX and quantification showed higher expression in PDAC than normal pancreas tissues. (B) IHC staining and quantification showed higher expression of LOXL1 in PDAC. (C) IHC staining and quantification showed higher expression of LOXL2 in PDAC. (D) IHC staining and quantification showed lower expression of LOXL3 in PDAC. (E) LOXL4 expression levels were similar in PDAC and normal tissues. *p < 0.01; NS, no significant difference. n = 6, repeated 5 times. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35433829), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for LOXL4 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-P, Retrieval method: HIER pH6. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: LOXL4
Long Name
Lysyl Oxidase like 4
Alternate Names
FLJ21889, LOX L4, LOXC
Gene Symbol
LOXL4
Additional LOXL4 Products
Product Documents for LOXL4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for LOXL4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for LOXL4 Antibody - BSA Free
Powered by Bioz
Customer Reviews for LOXL4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review LOXL4 Antibody - BSA Free and earn rewards!
Have you used LOXL4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...