Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

Novus Biologicals | Catalog # NBP3-16466

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9F0W6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 675-774 of human Lysyl Oxidase Homolog 2/LOXL2 (Q9Y4K0). NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

Western Blot: Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) [NBP3-16466]

Western Blot: Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) [NBP3-16466]

Western Blot: Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) [NBP3-16466] - Western blot analysis of extracts of various cell lines, using Lysyl Oxidase Homolog 2/LOXL2 Rabbit mAb (NBP3-16466) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Applications for Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lysyl Oxidase Homolog 2/LOXL2

LOXL2 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]

Alternate Names

LOL2, LOXL2

Gene Symbol

LOXL2

Additional Lysyl Oxidase Homolog 2/LOXL2 Products

Product Documents for Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)

There are currently no reviews for this product. Be the first to review Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6) and earn rewards!

Have you used Lysyl Oxidase Homolog 2/LOXL2 Antibody (9F0W6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...