Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79803

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human LOXL3The immunogen for this antibody is LOXL3. Peptide sequence AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free

Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803]

Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803]

Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803]

Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803]

Western Blot: Lysyl Oxidase Homolog 3/LOXL3 Antibody [NBP1-79803] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lysyl Oxidase Homolog 3/LOXL3

LOXL3 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. Alternatively spliced transcript variants of this gene have been reported but their full-length nature has not been determined.

Alternate Names

LOL3, LOXL3

Gene Symbol

LOXL3

UniProt

Additional Lysyl Oxidase Homolog 3/LOXL3 Products

Product Documents for Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free and earn rewards!

Have you used Lysyl Oxidase Homolog 3/LOXL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...