Mad Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85249

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Mad Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Mad. Peptide sequence: MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Mad Antibody - BSA Free

Western Blot: Mad Antibody [NBP2-85249]

Western Blot: Mad Antibody [NBP2-85249]

Western Blot: Mad Antibody [NBP2-85249] - Host: Mouse. Target Name: MXD1. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: Mad Antibody [NBP2-85249]

Western Blot: Mad Antibody [NBP2-85249]

Western Blot: Mad Antibody [NBP2-85249] - WB Suggested Anti-MXD1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle
Western Blot: Mad Antibody [NBP2-85249]

Western Blot: Mad Antibody [NBP2-85249]

Western Blot: Mad Antibody [NBP2-85249] - Host: Rabbit. Target: MXD1. Positive control (+): Mouse small intestine (M-IN). Negative control (-): Mouse testis (M-TE). Antibody concentration: 1ug/ml

Applications for Mad Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mad

MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. [provided by RefSeq]

Alternate Names

antagonizer of myc transcriptional activity, BHLHC58, MADMAD1, MAX dimerization protein 1, Max dimerizer 1, MAX-binding protein, MGC104659, Protein MAD

Gene Symbol

MXD1

Additional Mad Products

Product Documents for Mad Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Mad Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mad Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mad Antibody - BSA Free and earn rewards!

Have you used Mad Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies