MASP2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-81259PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MASP2.

Source: E. coli

Amino Acid Sequence: PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81259.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-81259PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MASP2

The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components that are involved in the mannan-binding lectin pathway of complement activation. The longer isoform is cleaved into two chains which form a heterodimer linked by a disulfide bond. The encoded proteins are members of the trypsin family of peptidases. [provided by RefSeq]

Alternate Names

EC 3.4.21, EC 3.4.21.104, mannan-binding lectin serine peptidase 1 pseudogene 1, mannan-binding lectin serine peptidase 2, mannan-binding lectin serine protease 1 pseudogene 1, mannan-binding lectin serine protease 2, Mannose-binding protein-associated serine protease 2, MAP19, MASP1P1, MASP-2, MBL-associated plasma protein of 19 kD, MBL-associated serine protease 2, small MBL-associated protein, sMAP

Gene Symbol

MASP2

Additional MASP2 Products

Product Documents for MASP2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MASP2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for MASP2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review MASP2 Recombinant Protein Antigen and earn rewards!

Have you used MASP2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for MASP2 Recombinant Protein Antigen

Showing  1 - 1 of 1 FAQ Showing All
  • Q: We wish to measure MASP-2 levels in human plasma. Are stored plasma (or serum) at -20 centigrade stabile for this measurement if only frozen once. Should we measure in duplicate or triplicate? Is plasma better than serum as I have both stored for the MASP-2 test? What would be the cost of a kit and how many samples would it measure? I assume there is no special equipment other than ELISA like stuff? What is the shelf life as I have holiday next month? Is the a list of equipment we need to run the kits so I can check it with our lab technicians.

    A:

    Once frozen samples should be fine for measurement. Generally, all experiments should be performed at least in triplicate so you can perform statistical analysis. MASP-2 should be detectable in both serum and plasma. Serum might yield cleaner signals since it is depleted of blood cells and clotting factors, but the depletion could, theoretically remove some MSAP-2 as well. Either type of sample should be suitable though. We currently have no MASP2 ELISA kits available. A list of our MASP2 antibodies can be found at this link if you would like to make your own. We guarantee all of our antibodies for 6 months from the receipt date.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...